Lineage for d2p5ma_ (2p5m A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958075Superfamily d.74.2: C-terminal domain of arginine repressor [55252] (2 families) (S)
    forms trimers with three closely packed beta-sheets
  5. 2958076Family d.74.2.1: C-terminal domain of arginine repressor [55253] (1 protein)
    automatically mapped to Pfam PF02863
  6. 2958077Protein C-terminal domain of arginine repressor [55254] (3 species)
  7. 2958088Species Bacillus subtilis [TaxId:1423] [69759] (2 PDB entries)
  8. 2958089Domain d2p5ma_: 2p5m A: [149254]
    automated match to d1b4ba_
    complexed with arg

Details for d2p5ma_

PDB Entry: 2p5m (more details), 1.95 Å

PDB Description: c-terminal domain hexamer of ahrc bound with l-arginine
PDB Compounds: (A:) Arginine repressor

SCOPe Domain Sequences for d2p5ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p5ma_ d.74.2.1 (A:) C-terminal domain of arginine repressor {Bacillus subtilis [TaxId: 1423]}
qrfnplsklkralmdafvkidsashmivlktmpgnaqaigalmdnldwdemmgticgddt
iliicrtpedtegvknrllell

SCOPe Domain Coordinates for d2p5ma_:

Click to download the PDB-style file with coordinates for d2p5ma_.
(The format of our PDB-style files is described here.)

Timeline for d2p5ma_: