| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.3: Arginine repressor (ArgR), N-terminal DNA-binding domain [46792] (2 proteins) automatically mapped to Pfam PF01316 |
| Protein Arginine repressor (ArgR), N-terminal DNA-binding domain [46793] (3 species) |
| Species Bacillus subtilis [TaxId:1423] [68966] (3 PDB entries) |
| Domain d2p5lh1: 2p5l H:2-64 [149253] automatically matched to d1f9nb1 protein/DNA complex; complexed with so4 |
PDB Entry: 2p5l (more details), 2.85 Å
SCOPe Domain Sequences for d2p5lh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p5lh1 a.4.5.3 (H:2-64) Arginine repressor (ArgR), N-terminal DNA-binding domain {Bacillus subtilis [TaxId: 1423]}
nkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsyk
ysl
Timeline for d2p5lh1: