Lineage for d2p5lc1 (2p5l C:2-64)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1720410Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1721437Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1721457Family a.4.5.3: Arginine repressor (ArgR), N-terminal DNA-binding domain [46792] (1 protein)
    automatically mapped to Pfam PF01316
  6. 1721458Protein Arginine repressor (ArgR), N-terminal DNA-binding domain [46793] (3 species)
  7. 1721466Species Bacillus subtilis [TaxId:1423] [68966] (3 PDB entries)
  8. 1721474Domain d2p5lc1: 2p5l C:2-64 [149250]
    automatically matched to d1f9nb1
    protein/DNA complex; complexed with so4

Details for d2p5lc1

PDB Entry: 2p5l (more details), 2.85 Å

PDB Description: Crystal structure of a dimer of N-terminal domains of AhrC in complex with an 18bp DNA operator site
PDB Compounds: (C:) Arginine repressor

SCOPe Domain Sequences for d2p5lc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p5lc1 a.4.5.3 (C:2-64) Arginine repressor (ArgR), N-terminal DNA-binding domain {Bacillus subtilis [TaxId: 1423]}
nkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsyk
ysl

SCOPe Domain Coordinates for d2p5lc1:

Click to download the PDB-style file with coordinates for d2p5lc1.
(The format of our PDB-style files is described here.)

Timeline for d2p5lc1: