Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (84 families) contains a small beta-sheet (wing) |
Family a.4.5.3: Arginine repressor (ArgR), N-terminal DNA-binding domain [46792] (1 protein) |
Protein Arginine repressor (ArgR), N-terminal DNA-binding domain [46793] (3 species) |
Species Bacillus subtilis [TaxId:1423] [68966] (3 PDB entries) |
Domain d2p5ka1: 2p5k A:2-64 [149249] automatically matched to d1f9nb1 |
PDB Entry: 2p5k (more details), 1 Å
SCOP Domain Sequences for d2p5ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p5ka1 a.4.5.3 (A:2-64) Arginine repressor (ArgR), N-terminal DNA-binding domain {Bacillus subtilis [TaxId: 1423]} nkgqrhikireiitsneietqdelvdmlkqdgykvtqatvsrdikelhlvkvptnngsyk ysl
Timeline for d2p5ka1: