![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
![]() | Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
![]() | Family d.104.1.3: LplA-like [143642] (6 proteins) part of Pfam PF03099 |
![]() | Protein Hypothetical protein BH3822 [160609] (1 species) |
![]() | Species Bacillus halodurans [TaxId:86665] [160610] (1 PDB entry) Uniprot Q9K6A7 12-276 |
![]() | Domain d2p5ia1: 2p5i A:14-278 [149248] |
PDB Entry: 2p5i (more details), 2.21 Å
SCOPe Domain Sequences for d2p5ia1:
Sequence, based on SEQRES records: (download)
>d2p5ia1 d.104.1.3 (A:14-278) Hypothetical protein BH3822 {Bacillus halodurans [TaxId: 86665]} pwrfldhtsfgptfqalqsfayddtlctsigksqspptlrawvhhntvvlgiqdsrlpqi kagiealkgfqhdvivrnsgglavvldsgilnlslvlkeekgfsiddgyelmyelicsmf qdhreqieareivgsycpgsydlsidgkkfagisqrrirggvavqiylcvsgsgaerakm irtfydkavagqptkfvyprikpetmaslsellgqphnvsdvllkalmtlqqhgasllte slsadewllyeqhfarisernekll
>d2p5ia1 d.104.1.3 (A:14-278) Hypothetical protein BH3822 {Bacillus halodurans [TaxId: 86665]} pwrfldhtsfgptfqalqsfayddtlctsigksqspptlrawvhhntvvlgiqdsrlpqi kagiealkgfqhdvivrnsgglavvldsgilnlslvlkeekgfsiddgyelmyelicsmf qeqieareivgsycpgsydlsidgkkfagisqrrirggvavqiylcvsgsgaerakmirt fydkavagqptkfvyprikpetmaslsellgqphnvsdvllkalmtlqqhgaslltesls adewllyeqhfarisernekll
Timeline for d2p5ia1: