Lineage for d2p5ea2 (2p5e A:1-181)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1197982Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1197983Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 1197984Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1198031Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (27 species)
  7. 1198044Species Human (Homo sapiens), HLA-A2.1 [TaxId:9606] [54470] (76 PDB entries)
    Uniprot P01892 25-298
  8. 1198070Domain d2p5ea2: 2p5e A:1-181 [149238]
    Other proteins in same PDB: d2p5ea1, d2p5eb_
    automatically matched to d1akja2
    complexed with epe, gol, ipa, mg, so4

Details for d2p5ea2

PDB Entry: 2p5e (more details), 1.89 Å

PDB Description: Crystal Structures of High Affinity Human T-Cell Receptors Bound to pMHC Reveal Native Diagonal Binding Geometry
PDB Compounds: (A:) HLA class I histocompatibility antigen, A-2 alpha chain

SCOPe Domain Sequences for d2p5ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p5ea2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-A2.1 [TaxId: 9606]}
gshsmryfftsvsrpgrgeprfiavgyvddtqfvrfdsdaasqrmeprapwieqegpeyw
dgetrkvkahsqthrvdlgtlrgyynqseagshtvqrmygcdvgsdwrflrgyhqyaydg
kdyialkedlrswtaadmaaqttkhkweaahvaeqlraylegtcvewlrrylengketlq
r

SCOPe Domain Coordinates for d2p5ea2:

Click to download the PDB-style file with coordinates for d2p5ea2.
(The format of our PDB-style files is described here.)

Timeline for d2p5ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p5ea1
View in 3D
Domains from other chains:
(mouse over for more information)
d2p5eb_