Lineage for d2p53b2 (2p53 B:54-350)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 816850Superfamily c.1.9: Metallo-dependent hydrolases [51556] (18 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 817102Family c.1.9.10: N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain [82261] (1 protein)
  6. 817103Protein N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain [82262] (3 species)
  7. 817107Species Escherichia coli [TaxId:562] [141808] (4 PDB entries)
    Uniprot P0AF18 54-350
  8. 817111Domain d2p53b2: 2p53 B:54-350 [149234]
    Other proteins in same PDB: d2p53a1, d2p53b1
    automatically matched to d1ymya2
    complexed with nng, zn; mutant

Details for d2p53b2

PDB Entry: 2p53 (more details), 2.1 Å

PDB Description: crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6- phosphate
PDB Compounds: (B:) N-acetylglucosamine-6-phosphate deacetylase

SCOP Domain Sequences for d2p53b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p53b2 c.1.9.10 (B:54-350) N-acetylglucosamine-6-phosphate deacetylase, NagA, catalytic domain {Escherichia coli [TaxId: 562]}
gfidvqlngcggvqfndtaeavsvetleimqkaneksgctnylptlittsdelmkqgvrv
mreylakhpnqalglhlegpwlnlvkkgthnpnfvrkpdaalvdflcenadvitkvtlap
emvpaevisklanagivvsaghsnatlkeakagfragitfathlynampyitgrepglag
aildeadiycgiiadglhvdyanirnakrlkgdklclvtnatapaganieqfifagktiy
yrnglcvdengtlsgssltmiegvrnlvehcgialdevlrmatlyparaigvekrlg

SCOP Domain Coordinates for d2p53b2:

Click to download the PDB-style file with coordinates for d2p53b2.
(The format of our PDB-style files is described here.)

Timeline for d2p53b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p53b1