SCOPe 2.05: Domain d2p53b1: 2p53 B:1-53,B:351-382

Lineage for d2p53b1 (2p53 B:1-53,B:351-382)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.5: N-acetylglucosamine-6-phosphate deacetylase, NagA [82227] (1 protein)

6. Protein N-acetylglucosamine-6-phosphate deacetylase, NagA [82228] (3 species)

7. Species Escherichia coli [TaxId:562] [141688] (4 PDB entries)
   Uniprot P0AF18 1-53,351-382

8. Domain d2p53b1: 2p53 B:1-53,B:351-382 [149233]
   Other proteins in same PDB: d2p53a2, d2p53b2
   automatically matched to d1ymya1
   complexed with nng, zn; mutant

Details for d2p53b1

PDB Entry: 2p53, 2.1 Å

PDB Description: crystal structure of n-acetyl-d-glucosamine-6-phosphate deacetylase d273n mutant complexed with n-acetyl phosphonamidate-d-glucosamine-6- phosphate

PDB Compounds: (B:) N-acetylglucosamine-6-phosphate deacetylase

SCOPe Domain Sequences for d2p53b1:

Sequence; same for both SEQRES and ATOM records:

>d2p53b1 b.92.1.5 (B:1-53,B:351-382) N-acetylglucosamine-6-phosphate deacetylase, NagA {Escherichia coli [TaxId: 562]}
myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspXtlaagk
vanltaftpdfkitktivngnevvtq

Timeline for d2p53b1:

• d2p53b1 first appeared in SCOP 1.75
  
• d2p53b1 appears in SCOPe 2.04
  
• d2p53b1 appears in SCOPe 2.06
  
• d2p53b1 appears in the current release, SCOPe 2.08