Lineage for d2p50c1 (2p50 C:1-53,C:351-382)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1810354Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 1810355Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 1810494Family b.92.1.5: N-acetylglucosamine-6-phosphate deacetylase, NagA [82227] (1 protein)
  6. 1810495Protein N-acetylglucosamine-6-phosphate deacetylase, NagA [82228] (3 species)
  7. 1810499Species Escherichia coli [TaxId:562] [141688] (4 PDB entries)
    Uniprot P0AF18 1-53,351-382
  8. 1810506Domain d2p50c1: 2p50 C:1-53,C:351-382 [149227]
    Other proteins in same PDB: d2p50a2, d2p50b2, d2p50c2, d2p50d2
    automated match to d1ymya1
    complexed with zn

Details for d2p50c1

PDB Entry: 2p50 (more details), 2.2 Å

PDB Description: Crystal structure of N-acetyl-D-Glucosamine-6-Phosphate deacetylase liganded with Zn
PDB Compounds: (C:) N-acetylglucosamine-6-phosphate deacetylase

SCOPe Domain Sequences for d2p50c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p50c1 b.92.1.5 (C:1-53,C:351-382) N-acetylglucosamine-6-phosphate deacetylase, NagA {Escherichia coli [TaxId: 562]}
myaltqgriftgheflddhavviadgliksvcpvaelppeieqrslngailspXtlaagk
vanltaftpdfkitktivngnevvtq

SCOPe Domain Coordinates for d2p50c1:

Click to download the PDB-style file with coordinates for d2p50c1.
(The format of our PDB-style files is described here.)

Timeline for d2p50c1: