Lineage for d2p4xa1 (2p4x A:6-238)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2617574Fold d.381: ATP12-like [160908] (1 superfamily)
    contains an N-terminal beta-sheet that forms a beta-triangle structure; the remainder is a multihelical array of long and short helices
  4. 2617575Superfamily d.381.1: ATP12-like [160909] (1 family) (S)
  5. 2617576Family d.381.1.1: ATP12-like [160910] (2 proteins)
    Pfam PF07542; F1-ATPase chaperone
  6. 2617577Protein ATP12 ATPase [160913] (1 species)
  7. 2617578Species Paracoccus denitrificans [TaxId:266] [160914] (3 PDB entries)
    Uniprot A1B060 2-235! Uniprot A1B060 3-235
  8. 2617580Domain d2p4xa1: 2p4x A:6-238 [149219]

Details for d2p4xa1

PDB Entry: 2p4x (more details), 1.9 Å

PDB Description: Crystal Structure of Atp12 from Paracoccus Denitrificans
PDB Compounds: (A:) ATP12 ATPase

SCOPe Domain Sequences for d2p4xa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4xa1 d.381.1.1 (A:6-238) ATP12 ATPase {Paracoccus denitrificans [TaxId: 266]}
ewkarrfwasvgihkeeggwavllderplrtpgkqplrlptealalaiaeewqavqevid
pnampltrsansaiekvapqfdavaamlgdyggtdllsyradapealvraqaegwdplid
waatelraplrithgvipvpqdpvvllklraevasldpfgltalhdlvtlpgslilglav
irgridaptahalsrideefqaerwgrdeeaeaqaasrlaamrdserfwhltr

SCOPe Domain Coordinates for d2p4xa1:

Click to download the PDB-style file with coordinates for d2p4xa1.
(The format of our PDB-style files is described here.)

Timeline for d2p4xa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2p4xb_