Lineage for d2p4pa1 (2p4p A:1-82)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 875230Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 875231Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (4 families) (S)
  5. 875354Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins)
    Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain
  6. 875373Protein Hypothetical protein HD1797 [160837] (1 species)
  7. 875374Species Haemophilus ducreyi [TaxId:730] [160838] (1 PDB entry)
    Uniprot Q7VKS4 347-428
  8. 875375Domain d2p4pa1: 2p4p A:1-82 [149217]
    complexed with ca, gol, mg, mly

Details for d2p4pa1

PDB Entry: 2p4p (more details), 1.8 Å

PDB Description: crystal structure of a corc_hlyc domain from haemophilus ducreyi
PDB Compounds: (A:) Hypothetical protein HD1797

SCOP Domain Sequences for d2p4pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4pa1 d.145.1.4 (A:1-82) Hypothetical protein HD1797 {Haemophilus ducreyi [TaxId: 730]}
mrrnedswlidgatpledvmralnihtfprdenyetiggfmmymlrkipkktdfvlydky
kfeiidtenfridqlmvsfrkd

SCOP Domain Coordinates for d2p4pa1:

Click to download the PDB-style file with coordinates for d2p4pa1.
(The format of our PDB-style files is described here.)

Timeline for d2p4pa1: