![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (4 families) ![]() |
![]() | Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins) Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain |
![]() | Protein Hypothetical protein HD1797 [160837] (1 species) |
![]() | Species Haemophilus ducreyi [TaxId:730] [160838] (1 PDB entry) Uniprot Q7VKS4 347-428 |
![]() | Domain d2p4pa1: 2p4p A:1-82 [149217] complexed with ca, gol, mg, mly |
PDB Entry: 2p4p (more details), 1.8 Å
SCOP Domain Sequences for d2p4pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p4pa1 d.145.1.4 (A:1-82) Hypothetical protein HD1797 {Haemophilus ducreyi [TaxId: 730]} mrrnedswlidgatpledvmralnihtfprdenyetiggfmmymlrkipkktdfvlydky kfeiidtenfridqlmvsfrkd
Timeline for d2p4pa1: