SCOPe 2.08: Domain d2p4pa1: 2p4p A:1-82

Lineage for d2p4pa1 (2p4p A:1-82)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins)
   Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain

6. Protein Hypothetical protein HD1797 [160837] (1 species)

7. Species Haemophilus ducreyi [TaxId:730] [160838] (1 PDB entry)
   Uniprot Q7VKS4 347-428

8. Domain d2p4pa1: 2p4p A:1-82 [149217]
   Other proteins in same PDB: d2p4pa2
   complexed with ca, gol, mg

Details for d2p4pa1

PDB Entry: 2p4p, 1.8 Å

PDB Description: crystal structure of a corc_hlyc domain from haemophilus ducreyi

PDB Compounds: (A:) Hypothetical protein HD1797

SCOPe Domain Sequences for d2p4pa1:

Sequence; same for both SEQRES and ATOM records:

>d2p4pa1 d.145.1.4 (A:1-82) Hypothetical protein HD1797 {Haemophilus ducreyi [TaxId: 730]}
mrrnedswlidgatpledvmralnihtfprdenyetiggfmmymlrkipkktdfvlydky
kfeiidtenfridqlmvsfrkd

Timeline for d2p4pa1:

• d2p4pa1 first appeared in SCOP 1.75
  
• d2p4pa1 appears in SCOPe 2.07