Lineage for d2p4oa1 (2p4o A:4-305)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2074740Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2075421Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) (S)
  5. 2075501Family b.68.6.3: All0351-like [159252] (1 protein)
    N-terminal half is PfamB 89298 and C-terminal half is PfamB 80276; includes recent entry 2qe8 (Ava4197)
  6. 2075502Protein Hypothetical protein All0351 homologue [159253] (1 species)
  7. 2075503Species Nostoc punctiforme [TaxId:272131] [159254] (1 PDB entry)
  8. 2075504Domain d2p4oa1: 2p4o A:4-305 [149216]
    complexed with act, gol

Details for d2p4oa1

PDB Entry: 2p4o (more details), 1.9 Å

PDB Description: crystal structure of a putative lactonase of the smp- 30/gluconolactonase/lre-like region family (npun_f0524) from nostoc punctiforme pcc 73102 at 1.90 a resolution
PDB Compounds: (A:) hypothetical protein

SCOPe Domain Sequences for d2p4oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]}
saglppiyadkpielapakiitsfpvntflenlasapdgtifvtnhevgeivsitpdgnq
qihatvegkvsglaftsngdlvatgwnadsipvvslvksdgtvetlltlpdaiflngitp
lsdtqyltadsyrgaiwlidvvqpsgsiwlehpmlarsnsesvfpaanglkrfgnflyvs
ntekmlllripvdstdkpgepeifveqtniddfafdvegnlygathiynsvvriapdrst
tiiaqaeqgvigstavafgqtegdctaiyvvtnggmflppptgvvpanvvrlevgkpgyp
lg

SCOPe Domain Coordinates for d2p4oa1:

Click to download the PDB-style file with coordinates for d2p4oa1.
(The format of our PDB-style files is described here.)

Timeline for d2p4oa1: