![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies) consists of six 4-stranded beta-sheet motifs; meander |
![]() | Superfamily b.68.6: Calcium-dependent phosphotriesterase [63829] (4 families) ![]() |
![]() | Family b.68.6.3: All0351-like [159252] (1 protein) N-terminal half is PfamB 89298 and C-terminal half is PfamB 80276; includes recent entry 2qe8 (Ava4197) |
![]() | Protein Hypothetical protein All0351 homologue [159253] (1 species) |
![]() | Species Nostoc punctiforme [TaxId:272131] [159254] (1 PDB entry) |
![]() | Domain d2p4oa1: 2p4o A:4-305 [149216] complexed with act, gol |
PDB Entry: 2p4o (more details), 1.9 Å
SCOPe Domain Sequences for d2p4oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} saglppiyadkpielapakiitsfpvntflenlasapdgtifvtnhevgeivsitpdgnq qihatvegkvsglaftsngdlvatgwnadsipvvslvksdgtvetlltlpdaiflngitp lsdtqyltadsyrgaiwlidvvqpsgsiwlehpmlarsnsesvfpaanglkrfgnflyvs ntekmlllripvdstdkpgepeifveqtniddfafdvegnlygathiynsvvriapdrst tiiaqaeqgvigstavafgqtegdctaiyvvtnggmflppptgvvpanvvrlevgkpgyp lg
Timeline for d2p4oa1: