Lineage for d2p4nb1 (2p4n B:2-437)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3044903Fold i.10: Microtubule complexes [58193] (1 superfamily)
  4. 3044904Superfamily i.10.1: Microtubule complexes [58194] (1 family) (S)
  5. 3044905Family i.10.1.1: Microtubule complexes [58195] (2 proteins)
  6. 3044911Protein Tubulin:stathmin-like domain complex [58196] (2 species)
  7. 3044912Species Cow (Bos taurus) [TaxId:9913] [161286] (2 PDB entries)
  8. 3044916Domain d2p4nb1: 2p4n B:2-437 [149215]
    automatically matched to d1ffxb_
    complexed with adp, gdp, gtp, mg, ta1, zn

Details for d2p4nb1

PDB Entry: 2p4n (more details), 9 Å

PDB Description: human monomeric kinesin (1bg2) and bovine tubulin (1jff) docked into the 9-angstrom cryo-em map of nucleotide-free kinesin complexed to the microtubule
PDB Compounds: (B:) Tubulin beta chain

SCOPe Domain Sequences for d2p4nb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4nb1 i.10.1.1 (B:2-437) Tubulin:stathmin-like domain complex {Cow (Bos taurus) [TaxId: 9913]}
reivhiqagqcgnqigakfwevisdehgidptgsyhgdsdlqlerinvyyneaagnkyvp
railvdlepgtmdsvrsgpfgqifrpdnfvfgqsgagnnwakghytegaelvdsvldvvr
kesescdclqgfqlthslgggtgsgmgtlliskireeypdrimntfsvvpspkvsdtvve
pynatlsvhqlventdetycidnealydicfrtlklttptygdlnhlvsatmsgvttclr
fpgqlnadlrklavnmvpfprlhffmpgfapltsrgsqqyraltvpeltqqmfdaknmma
acdprhgryltvaavfrgrmsmkevdeqmlnvqnknssyfvewipnnvktavcdipprgl
kmsatfignstaiqelfkriseqftamfrrkaflhwytgegmdemefteaesnmndlvse
yqqyqd

SCOPe Domain Coordinates for d2p4nb1:

Click to download the PDB-style file with coordinates for d2p4nb1.
(The format of our PDB-style files is described here.)

Timeline for d2p4nb1: