Lineage for d2p4aa_ (2p4a A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2174483Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2174484Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2174485Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2174918Protein automated matches [190061] (7 species)
    not a true protein
  7. 2174921Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries)
  8. 2175004Domain d2p4aa_: 2p4a A: [149208]
    Other proteins in same PDB: d2p4ab_, d2p4ad_
    automated match to d1a2wa_
    protein/RNA complex; complexed with so4

Details for d2p4aa_

PDB Entry: 2p4a (more details), 1.9 Å

PDB Description: X-ray structure of a camelid affinity matured single-domain vhh antibody fragment in complex with RNASE A
PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d2p4aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4aa_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d2p4aa_:

Click to download the PDB-style file with coordinates for d2p4aa_.
(The format of our PDB-style files is described here.)

Timeline for d2p4aa_: