Lineage for d2p48a1 (2p48 A:21-124)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 851941Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 851942Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulfide-rich
  5. 851943Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 852017Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 852018Species Cow (Bos taurus) [TaxId:9913] [54079] (154 PDB entries)
  8. 852200Domain d2p48a1: 2p48 A:21-124 [149205]
    automatically matched to d1rbca_
    complexed with so4

Details for d2p48a1

PDB Entry: 2p48 (more details), 2.3 Å

PDB Description: Complex of a camelid single-domain vhh antibody fragment with RNASE A at 2.3A resolution: SE5B-tetra crystal form with five se-met sites (L4M, M34, M51, F68M, M83) in vhh scaffold.
PDB Compounds: (A:) ribonuclease pancreatic

SCOP Domain Sequences for d2p48a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p48a1 d.5.1.1 (A:21-124) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
sssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystms
itdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

SCOP Domain Coordinates for d2p48a1:

Click to download the PDB-style file with coordinates for d2p48a1.
(The format of our PDB-style files is described here.)

Timeline for d2p48a1: