Lineage for d2p46a_ (2p46 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2928015Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2928016Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2928017Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2928489Protein automated matches [190061] (7 species)
    not a true protein
  7. 2928492Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries)
  8. 2928600Domain d2p46a_: 2p46 A: [149202]
    Other proteins in same PDB: d2p46b_, d2p46d_
    automated match to d1a2wa_
    protein/RNA complex; complexed with zn

Details for d2p46a_

PDB Entry: 2p46 (more details), 2.5 Å

PDB Description: Complex of a camelid single-domain vhh antibody fragment with RNASE A at 2.5A resolution: se5b-ortho-2 crystal form with five se-met sites (L4M, M34, M51, F68M, M83) in vhh scaffold.
PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d2p46a_:

Sequence, based on SEQRES records: (download)

>d2p46a_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
etaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsqk
nvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfd
asv

Sequence, based on observed residues (ATOM records): (download)

>d2p46a_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
etaaakferqhmdsstsaasssnycnqmmksrnltckpvntfvhesladvqavcsqknva
ckngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

SCOPe Domain Coordinates for d2p46a_:

Click to download the PDB-style file with coordinates for d2p46a_.
(The format of our PDB-style files is described here.)

Timeline for d2p46a_: