SCOPe 2.07: Domain d2p45a_: 2p45 A:

Lineage for d2p45a_ (2p45 A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries)

8. Domain d2p45a_: 2p45 A: [149201]
   Other proteins in same PDB: d2p45b_
   automated match to d1a2wa_
   protein/RNA complex; complexed with so4

Details for d2p45a_

PDB Entry: 2p45, 1.1 Å

PDB Description: Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.1A resolution: SE5B-ORTHO-1 crystal form with five se-met sites (L4M, M34, M51, F68M, M83) in vhh scaffold.

PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d2p45a_:

Sequence; same for both SEQRES and ATOM records:

>d2p45a_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d2p45a_:

• d2p45a_ first appeared in SCOP 1.75, called d2p45a1
  
• d2p45a_ appears in SCOPe 2.06
  
• d2p45a_ appears in the current release, SCOPe 2.08