SCOP 1.75: Domain d2p43a1: 2p43 A:21-124

Lineage for d2p43a1 (2p43 A:21-124)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (1 family)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)

6. Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [54079] (154 PDB entries)

8. Domain d2p43a1: 2p43 A:21-124 [149198]
   Other proteins in same PDB: d2p43b1
   automatically matched to d1rbca_

Details for d2p43a1

PDB Entry: 2p43, 1.65 Å

PDB Description: Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.65A resolution: SE3-mono-1 crystal form with three se-met sites (M34, M51, M83) in vhh scaffold

PDB Compounds: (A:) ribonuclease pancreatic

SCOP Domain Sequences for d2p43a1:

Sequence; same for both SEQRES and ATOM records:

>d2p43a1 d.5.1.1 (A:21-124) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
sssnycnqmmksrnltkdrckpvntfvhesladvqavcsqknvackngqtncyqsystms
itdcretgsskypncaykttqankhiivacegnpyvpvhfdasv

Timeline for d2p43a1:

• d2p43a1 is new in SCOP 1.75
  
• d2p43a1 is called d2p43a_ in SCOPe 2.01
  
• d2p43a1 appears in the current release, SCOPe 2.08, called d2p43a_