SCOPe 2.08: Domain d2p43a_: 2p43 A:

Lineage for d2p43a_ (2p43 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)

6. Protein automated matches [190061] (7 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries)

8. Domain d2p43a_: 2p43 A: [149198]
   Other proteins in same PDB: d2p43b_
   automated match to d1a2wa_
   protein/RNA complex

Details for d2p43a_

PDB Entry: 2p43, 1.65 Å

PDB Description: Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.65A resolution: SE3-mono-1 crystal form with three se-met sites (M34, M51, M83) in vhh scaffold

PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d2p43a_:

Sequence; same for both SEQRES and ATOM records:

>d2p43a_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

Timeline for d2p43a_:

• d2p43a_ first appeared in SCOP 1.75, called d2p43a1
  
• d2p43a_ appears in SCOPe 2.07