Lineage for d2p42c_ (2p42 C:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1399946Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1399947Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1399948Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1400307Protein automated matches [190061] (4 species)
    not a true protein
  7. 1400308Species Cow (Bos taurus) [TaxId:9913] [186780] (70 PDB entries)
  8. 1400372Domain d2p42c_: 2p42 C: [149196]
    Other proteins in same PDB: d2p42b_, d2p42d_
    automated match to d1a2wa_
    protein/RNA complex; complexed with mg

Details for d2p42c_

PDB Entry: 2p42 (more details), 1.8 Å

PDB Description: Complex of a camelid single-domain vhh antibody fragment with RNASE A at 1.8A resolution: SE3-mono-2 crystal form with three se-met sites (M34, M51, M83) in vhh scaffold
PDB Compounds: (C:) ribonuclease pancreatic

SCOPe Domain Sequences for d2p42c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p42c_ d.5.1.1 (C:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d2p42c_:

Click to download the PDB-style file with coordinates for d2p42c_.
(The format of our PDB-style files is described here.)

Timeline for d2p42c_: