Lineage for d2p3qa_ (2p3q A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2893582Family c.66.1.25: mRNA cap methylase [88785] (4 proteins)
  6. 2893583Protein An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 [89741] (2 species)
    structurally and functionally similar to VP39
  7. 2893584Species Flavivirus (Dengue virus type 2) [TaxId:12637] [89742] (8 PDB entries)
    Uniprot P12823 2495-2756
  8. 2893591Domain d2p3qa_: 2p3q A: [149185]
    automated match to d1l9ka_
    complexed with gp3, sah, so4

Details for d2p3qa_

PDB Entry: 2p3q (more details), 2.75 Å

PDB Description: Crystal Structure of Dengue Methyltransferase in Complex with GpppG and S-Adenosyl-L-homocysteine
PDB Compounds: (A:) type II methyltransferase

SCOPe Domain Sequences for d2p3qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p3qa_ c.66.1.25 (A:) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Flavivirus (Dengue virus type 2) [TaxId: 12637]}
etlgekwksrlnalgksefqiykksgiqevdrtlakegikrgetdhhavsrgsaklrwfv
ernlvtpegkvvdlgcgrggwsyycgglknvrevkgltkggpgheepipmstygwnlvrl
qsgvdvffippercdtllcdigesspnptveagrtlrvlnlvenwlsnntqfcvkvlnpy
mssviekmealqrkhggalvrnplsrnsthemywvsnasgnivssvnmisrmlinrftmr
hkkatyepdvdlgsgtrn

SCOPe Domain Coordinates for d2p3qa_:

Click to download the PDB-style file with coordinates for d2p3qa_.
(The format of our PDB-style files is described here.)

Timeline for d2p3qa_: