SCOPe 2.06: Domain d2p3ka_: 2p3k A:

Lineage for d2p3ka_ (2p3k A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins)
   automatically mapped to Pfam PF00426

6. Protein vp4 sialic acid binding domain [74908] (1 species)

7. Species Rhesus rotavirus [TaxId:10969] [74909] (6 PDB entries)

8. Domain d2p3ka_: 2p3k A: [149179]
   automated match to d1kqra_
   complexed with gol, mna, so4

Details for d2p3ka_

PDB Entry: 2p3k, 1.56 Å

PDB Description: crystal structure of rhesus rotavirus vp8* at 100k

PDB Compounds: (A:) vp4

SCOPe Domain Sequences for d2p3ka_:

Sequence; same for both SEQRES and ATOM records:

>d2p3ka_ b.29.1.14 (A:) vp4 sialic acid binding domain {Rhesus rotavirus [TaxId: 10969]}
vldgpyqpttfnppvdywmllaptaagvvvegtnntdrwlatilvepnvtsetrsytlfg
tqeqitianasqtqwkfidvvkttqngsysqygplqstpklyavmkhngkiytyngetpn
vttkyysttnydsvnmtafcdfyiipreeestcteyinngl

Timeline for d2p3ka_:

• d2p3ka_ first appeared in SCOP 1.75, called d2p3ka1
  
• d2p3ka_ appears in SCOPe 2.05
  
• d2p3ka_ appears in SCOPe 2.07
  
• d2p3ka_ appears in the current release, SCOPe 2.08