| Class b: All beta proteins [48724] (177 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) ![]() |
| Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins) automatically mapped to Pfam PF00426 |
| Protein vp4 sialic acid binding domain [74908] (1 species) |
| Species Rhesus rotavirus [TaxId:10969] [74909] (6 PDB entries) |
| Domain d2p3ka_: 2p3k A: [149179] automated match to d1kqra_ complexed with gol, mna, so4 |
PDB Entry: 2p3k (more details), 1.56 Å
SCOPe Domain Sequences for d2p3ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p3ka_ b.29.1.14 (A:) vp4 sialic acid binding domain {Rhesus rotavirus [TaxId: 10969]}
vldgpyqpttfnppvdywmllaptaagvvvegtnntdrwlatilvepnvtsetrsytlfg
tqeqitianasqtqwkfidvvkttqngsysqygplqstpklyavmkhngkiytyngetpn
vttkyysttnydsvnmtafcdfyiipreeestcteyinngl
Timeline for d2p3ka_: