Lineage for d2p2ub_ (2p2u B:)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3042247Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
    this is not a true fold; contains at least two very long antiparallel helices
  4. 3042413Superfamily h.4.18: Gam-like [161266] (1 family) (S)
    homodimeric fold with a ring-like structure formed by kinked coiled-coil and a beta-ribboon, interrupted by small helical insertions
  5. 3042414Family h.4.18.1: Gam-like [161267] (1 protein)
    Pfam PF07352; Bacteriophage Mu Gam-like protein
  6. 3042415Protein Host-nuclease inhibitor protein Gam, putative [161268] (1 species)
  7. 3042416Species Desulfovibrio vulgaris [TaxId:881] [161269] (1 PDB entry)
    Uniprot Q72CZ5 9-161
  8. 3042418Domain d2p2ub_: 2p2u B: [149174]
    automated match to d2p2ua1

Details for d2p2ub_

PDB Entry: 2p2u (more details), 2.75 Å

PDB Description: crystal structure of putative host-nuclease inhibitor protein gam from desulfovibrio vulgaris
PDB Compounds: (B:) Host-nuclease inhibitor protein Gam, putative

SCOPe Domain Sequences for d2p2ub_:

Sequence, based on SEQRES records: (download)

>d2p2ub_ h.4.18.1 (B:) Host-nuclease inhibitor protein Gam, putative {Desulfovibrio vulgaris [TaxId: 881]}
vivadirqaegalaeiatidrkvgeieaqmneaidaakarasqksapllarrkeledgva
tfatlnktemfkdrksldlgfgtigfrlstqivqmskitkdmtlerlrqfgisegirike
dvnkeamqgwpderlemvglkrrttdafyieinreev

Sequence, based on observed residues (ATOM records): (download)

>d2p2ub_ h.4.18.1 (B:) Host-nuclease inhibitor protein Gam, putative {Desulfovibrio vulgaris [TaxId: 881]}
vivadirqaegalaeiatidrkvgeieaqmneaidaakarasqksapllarrkeledgva
tfatlnktemfsldlgfgtigfrlstqivqmskitkdmtlerlrqfgisegirikedvnk
eamqgwpderlemvglkrrttdafyieinreev

SCOPe Domain Coordinates for d2p2ub_:

Click to download the PDB-style file with coordinates for d2p2ub_.
(The format of our PDB-style files is described here.)

Timeline for d2p2ub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2p2ua1