SCOPe 2.07: Domain d2p2ua1: 2p2u A:9-161

Lineage for d2p2ua1 (2p2u A:9-161)

1. Root: SCOPe 2.07

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.4: Antiparallel coiled-coil [58086] (19 superfamilies)
   this is not a true fold; contains at least two very long antiparallel helices

4. Superfamily h.4.18: Gam-like [161266] (1 family)
   homodimeric fold with a ring-like structure formed by kinked coiled-coil and a beta-ribboon, interrupted by small helical insertions

5. Family h.4.18.1: Gam-like [161267] (1 protein)
   Pfam PF07352; Bacteriophage Mu Gam-like protein

6. Protein Host-nuclease inhibitor protein Gam, putative [161268] (1 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [161269] (1 PDB entry)
   Uniprot Q72CZ5 9-161

8. Domain d2p2ua1: 2p2u A:9-161 [149173]

Details for d2p2ua1

PDB Entry: 2p2u, 2.75 Å

PDB Description: crystal structure of putative host-nuclease inhibitor protein gam from desulfovibrio vulgaris

PDB Compounds: (A:) Host-nuclease inhibitor protein Gam, putative

SCOPe Domain Sequences for d2p2ua1:

Sequence, based on SEQRES records:

>d2p2ua1 h.4.18.1 (A:9-161) Host-nuclease inhibitor protein Gam, putative {Desulfovibrio vulgaris [TaxId: 881]}
vivadirqaegalaeiatidrkvgeieaqmneaidaakarasqksapllarrkeledgva
tfatlnktemfkdrksldlgfgtigfrlstqivqmskitkdmtlerlrqfgisegirike
dvnkeamqgwpderlemvglkrrttdafyiein

Sequence, based on observed residues (ATOM records):

>d2p2ua1 h.4.18.1 (A:9-161) Host-nuclease inhibitor protein Gam, putative {Desulfovibrio vulgaris [TaxId: 881]}
vivadirqaegalaeiatidrkvgeieaqmneaidaakarasqksapllarrkeledgva
tfatlnktemfksldlgfgtigfrlstqivqmskitkdmtlerlrqfgisegirikedvn
keamqgwpderlemvglkrrttdafyiein

Timeline for d2p2ua1:

• d2p2ua1 first appeared in SCOP 1.75
  
• d2p2ua1 appears in SCOPe 2.06
  
• d2p2ua1 appears in the current release, SCOPe 2.08