Lineage for d2p2ea1 (2p2e A:4-120)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2433166Fold b.124: HesB-like domain [89359] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 2433167Superfamily b.124.1: HesB-like domain [89360] (2 families) (S)
  5. 2433168Family b.124.1.1: HesB-like domain [89361] (3 proteins)
    Pfam PF01521; Iron-sulfur cluster scaffold domain
  6. 2433180Protein Putative Fe-S biosynthesis protein LSL1730 [159226] (1 species)
  7. 2433181Species Lactobacillus salivarius [TaxId:1624] [159227] (1 PDB entry)
    Uniprot Q1WRG6 1-118
  8. 2433182Domain d2p2ea1: 2p2e A:4-120 [149171]
    Other proteins in same PDB: d2p2ea2, d2p2ea3

Details for d2p2ea1

PDB Entry: 2p2e (more details), 2.48 Å

PDB Description: crystal structure of a putative fe-s biosynthesis protein from lactobacillus salivarius with novel protein fold
PDB Compounds: (A:) Putative Fe-S biosynthesis protein

SCOPe Domain Sequences for d2p2ea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p2ea1 b.124.1.1 (A:4-120) Putative Fe-S biosynthesis protein LSL1730 {Lactobacillus salivarius [TaxId: 1624]}
kitvtddaakklqrytddsnavllldfddgvgalskvgvcslnsdfrilvvskdmdykkd
ynevidsnigkfyykgyskmymddnmkislntnnsllrltgdnsgelmpalsiqdfr

SCOPe Domain Coordinates for d2p2ea1:

Click to download the PDB-style file with coordinates for d2p2ea1.
(The format of our PDB-style files is described here.)

Timeline for d2p2ea1: