SCOP 1.75: Domain d2p24a1: 2p24 A:82-181

Lineage for d2p24a1 (2p24 A:82-181)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class II MHC alpha chain, C-terminal domain [88618] (6 species)

7. Species Mouse (Mus musculus), I-A group [TaxId:10090] [88624] (26 PDB entries)
   probably orthologous to the human HLA-DQ group

8. Domain d2p24a1: 2p24 A:82-181 [149169]
   Other proteins in same PDB: d2p24a2
   automatically matched to d1k2da1

Details for d2p24a1

PDB Entry: 2p24, 2.15 Å

PDB Description: I-Au/MBP125-135

PDB Compounds: (A:) H-2 class II histocompatibility antigen, A-U alpha chain

SCOP Domain Sequences for d2p24a1:

Sequence; same for both SEQRES and ATOM records:

>d2p24a1 b.1.1.2 (A:82-181) Class II MHC alpha chain, C-terminal domain {Mouse (Mus musculus), I-A group [TaxId: 10090]}
atneapqatvfpkspvllgqpntlicfvdnifppvinitwlrnsksvadgvyetsffvnr
dysfhklsyltfipsdddiydckvehwgleepvlkhwepe

Timeline for d2p24a1:

• d2p24a1 is new in SCOP 1.75
  
• d2p24a1 appears in SCOPe 2.01
  
• d2p24a1 appears in the current release, SCOPe 2.08