Lineage for d2p1va1 (2p1v A:229-458)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 776482Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 776483Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 776484Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (33 protein domains)
  6. 776945Protein Retinoid-X receptor alpha (RXR-alpha) [48510] (2 species)
  7. 776946Species Human (Homo sapiens) [TaxId:9606] [48511] (18 PDB entries)
    Uniprot P19793 227-458
  8. 776955Domain d2p1va1: 2p1v A:229-458 [149167]
    automatically matched to d1lbda_
    complexed with 5tn

Details for d2p1va1

PDB Entry: 2p1v (more details), 2.2 Å

PDB Description: Crystal structure of the ligand binding domain of the retinoid X receptor alpha in complex with 3-(2'-propoxy)-tetrahydronaphtyl cinnamic acid and a fragment of the coactivator TIF-2
PDB Compounds: (A:) Retinoic acid receptor RXR-alpha

SCOP Domain Sequences for d2p1va1:

Sequence, based on SEQRES records: (download)

>d2p1va1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
dmpverileaelavepktetyveanmglnpsspndpvtnicqaadkqlftlvewakriph
fselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgaifdr
vltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhky
peqpgrfaklllrlpalrsiglkclehlfffkligdtpidtflmemleap

Sequence, based on observed residues (ATOM records): (download)

>d2p1va1 a.123.1.1 (A:229-458) Retinoid-X receptor alpha (RXR-alpha) {Human (Homo sapiens) [TaxId: 9606]}
dmpverileaelavedpvtnicqaadkqlftlvewakriphfselplddqvillragwne
lliasfshrsiavkdgillatglhvhrnsahsagvgaifdrvltelvskmrdmqmdktel
gclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgrfaklllrlpalrs
iglkclehlfffkligdtpidtflmemleap

SCOP Domain Coordinates for d2p1va1:

Click to download the PDB-style file with coordinates for d2p1va1.
(The format of our PDB-style files is described here.)

Timeline for d2p1va1: