Lineage for d2p1rd1 (2p1r D:1-299)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 885795Fold e.52: NAD kinase/diacylglycerol kinase-like [111330] (1 superfamily)
    2 domains: d1 [alpha/beta; related to the PFK N-terminal domain ((53784))]; d2 [all-beta; atypical beta-sandwich made of 4 structural repeats of beta(3) unit]
    2 domains: d1 [alpha/beta; related to the PFK N-terminal domain ((53784))]; d2 [all-beta; atypical beta-sandwich made of 4 structural repeats of beta(3) unit]
  4. 885796Superfamily e.52.1: NAD kinase/diacylglycerol kinase-like [111331] (2 families) (S)
  5. 885823Family e.52.1.2: Diacylglycerol kinase-like [160984] (2 proteins)
    N-terminal, catalytic domain is covered by Pfam PF00781
  6. 885828Protein Lipid kinase YegS [160985] (2 species)
  7. 885833Species Salmonella typhimurium [TaxId:90371] [160986] (1 PDB entry)
    Uniprot Q8ZNP1 1-299
  8. 885837Domain d2p1rd1: 2p1r D:1-299 [149164]
    automatically matched to 2P1R A:1-299
    complexed with ca, cl, na

Details for d2p1rd1

PDB Entry: 2p1r (more details), 2.5 Å

PDB Description: crystal structure of salmonella typhimurium yegs, a putative lipid kinase homologous to eukaryotic sphingosine and diacylglycerol kinases.
PDB Compounds: (D:) Lipid kinase yegS

SCOP Domain Sequences for d2p1rd1:

Sequence, based on SEQRES records: (download)

>d2p1rd1 e.52.1.2 (D:1-299) Lipid kinase YegS {Salmonella typhimurium [TaxId: 90371]}
manfpasllilngksadnqplreaitllrdegiqihvrvtwekgdaqryvdearrlgvet
viagggdgtinevstaliqirdgvapalgllplgtandfatsagipealdkalklaiagn
ameidmamvndktcfinmatggfgtrittetpeklkaalggvsylihglmrmdtltpdrc
eirgenfhwqgdalvigigngrqagggqqlcptalindgllqlriftgeellpalfstlt
qsddnpniidgasawfdihapheitfnldgeplsgqefhievlpgalrcrlppdcpllr

Sequence, based on observed residues (ATOM records): (download)

>d2p1rd1 e.52.1.2 (D:1-299) Lipid kinase YegS {Salmonella typhimurium [TaxId: 90371]}
manfpasllilngksadnqplreaitllrdegiqihvrvtwekgdaqryvdearrlgvet
viagggdgtinevstaliqirdgvapalgllplgtandfatsagipealdkalklaiagn
ameidmamvndktcfinmatggfggvsylihglmrmdtltpdrceirgenfhwqgdalvi
gigngrqagggqqlcptalindgllqlriftgeellpalfstltqsddnpniidgasawf
dihapheitfnldgeplsgqefhievlpgalrcrlppdcpllr

SCOP Domain Coordinates for d2p1rd1:

Click to download the PDB-style file with coordinates for d2p1rd1.
(The format of our PDB-style files is described here.)

Timeline for d2p1rd1: