Lineage for d2p13a1 (2p13 A:431-515)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2593699Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
    consists of two alpha+beta subdomains
  4. 2593700Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) (S)
  5. 2593884Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins)
    Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain
  6. 2593933Protein Uncharacterized protein NE2227 [160825] (1 species)
  7. 2593934Species Nitrosomonas europaea [TaxId:915] [160826] (1 PDB entry)
    Uniprot Q82SS8 431-515
  8. 2593935Domain d2p13a1: 2p13 A:431-515 [149152]
    complexed with acy

Details for d2p13a1

PDB Entry: 2p13 (more details), 1.65 Å

PDB Description: transporter associated domain corc_hlyc from nitrosomonas europaea
PDB Compounds: (A:) CBS domain

SCOPe Domain Sequences for d2p13a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p13a1 d.145.1.4 (A:431-515) Uncharacterized protein NE2227 {Nitrosomonas europaea [TaxId: 915]}
ekvvaeqqadgtwlmdgwisirkasnllehdlvdeaerystlggyllwqfgyipaageqi
tvdglifeivsvnkhnigkvrvhrt

SCOPe Domain Coordinates for d2p13a1:

Click to download the PDB-style file with coordinates for d2p13a1.
(The format of our PDB-style files is described here.)

Timeline for d2p13a1: