![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily) consists of two alpha+beta subdomains |
![]() | Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families) ![]() |
![]() | Family d.145.1.4: CorC/HlyC domain-like [160820] (12 proteins) Pfam PF03471; similar to the C-terminal subdomain of FAD-binding domain with transposition of strands 3 and 4; possible adenosine cofactor-binding domain |
![]() | Protein Uncharacterized protein NE2227 [160825] (1 species) |
![]() | Species Nitrosomonas europaea [TaxId:915] [160826] (1 PDB entry) Uniprot Q82SS8 431-515 |
![]() | Domain d2p13a1: 2p13 A:431-515 [149152] complexed with acy |
PDB Entry: 2p13 (more details), 1.65 Å
SCOPe Domain Sequences for d2p13a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p13a1 d.145.1.4 (A:431-515) Uncharacterized protein NE2227 {Nitrosomonas europaea [TaxId: 915]} ekvvaeqqadgtwlmdgwisirkasnllehdlvdeaerystlggyllwqfgyipaageqi tvdglifeivsvnkhnigkvrvhrt
Timeline for d2p13a1: