Lineage for d2p12b1 (2p12 B:9-172)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 814145Fold b.175: FomD barrel-like [159233] (1 superfamily)
    barrel, closed; n=8, S=12; meander; similar topology to the AOC barrel-like fold (reversed to the lipocalin barrel topology)
  4. 814146Superfamily b.175.1: FomD-like [159234] (1 family) (S)
  5. 814147Family b.175.1.1: FomD-like [159235] (1 protein)
    Pfam PF04167; DUF402
  6. 814148Protein Hypothetical protein RHA1_ro00977 [159236] (1 species)
  7. 814149Species Rhodococcus sp. RHA1 [TaxId:101510] [159237] (1 PDB entry)
    Uniprot Q0SI31 8-172
  8. 814151Domain d2p12b1: 2p12 B:9-172 [149151]
    automatically matched to 2P12 A:8-172
    complexed with acy, gol

Details for d2p12b1

PDB Entry: 2p12 (more details), 1.63 Å

PDB Description: crystal structure of protein of unknown function duf402 from rhodococcus sp. rha1
PDB Compounds: (B:) Hypothetical protein DUF402

SCOP Domain Sequences for d2p12b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p12b1 b.175.1.1 (B:9-172) Hypothetical protein RHA1_ro00977 {Rhodococcus sp. RHA1 [TaxId: 101510]}
hppkveyfdlrdhtntdpkgfvrhvdhyrvepwglymartsdhpqfhyleswllpdlglr
asifhyhpyhqrdqdhyvdigtftrgddvwksedhyldlvvrtgrdtelldvdelmeaht
tglldtataeqailtattaidgiaahghdlgrwlasigmpidwr

SCOP Domain Coordinates for d2p12b1:

Click to download the PDB-style file with coordinates for d2p12b1.
(The format of our PDB-style files is described here.)

Timeline for d2p12b1: