![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.175: FomD barrel-like [159233] (1 superfamily) barrel, closed; n=8, S=12; meander; similar topology to the AOC barrel-like fold (reversed to the lipocalin barrel topology) |
![]() | Superfamily b.175.1: FomD-like [159234] (1 family) ![]() |
![]() | Family b.175.1.1: FomD-like [159235] (1 protein) Pfam PF04167; DUF402 |
![]() | Protein Hypothetical protein RHA1_ro00977 [159236] (1 species) |
![]() | Species Rhodococcus sp. RHA1 [TaxId:101510] [159237] (1 PDB entry) Uniprot Q0SI31 8-172 |
![]() | Domain d2p12b2: 2p12 B:9-172 [149151] Other proteins in same PDB: d2p12a2, d2p12b3 automated match to d2p12a1 complexed with acy, gol |
PDB Entry: 2p12 (more details), 1.63 Å
SCOPe Domain Sequences for d2p12b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p12b2 b.175.1.1 (B:9-172) Hypothetical protein RHA1_ro00977 {Rhodococcus sp. RHA1 [TaxId: 101510]} hppkveyfdlrdhtntdpkgfvrhvdhyrvepwglymartsdhpqfhyleswllpdlglr asifhyhpyhqrdqdhyvdigtftrgddvwksedhyldlvvrtgrdtelldvdelmeaht tglldtataeqailtattaidgiaahghdlgrwlasigmpidwr
Timeline for d2p12b2: