SCOP 1.75: Domain d2p12a1: 2p12 A:8-172

Lineage for d2p12a1 (2p12 A:8-172)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.175: FomD barrel-like [159233] (1 superfamily)
   barrel, closed; n=8, S=12; meander; similar topology to the AOC barrel-like fold (reversed to the lipocalin barrel topology)

4. Superfamily b.175.1: FomD-like [159234] (1 family)

5. Family b.175.1.1: FomD-like [159235] (1 protein)
   Pfam PF04167; DUF402

6. Protein Hypothetical protein RHA1_ro00977 [159236] (1 species)

7. Species Rhodococcus sp. RHA1 [TaxId:101510] [159237] (1 PDB entry)
   Uniprot Q0SI31 8-172

8. Domain d2p12a1: 2p12 A:8-172 [149150]
   complexed with acy, gol

Details for d2p12a1

PDB Entry: 2p12, 1.63 Å

PDB Description: crystal structure of protein of unknown function duf402 from rhodococcus sp. rha1

PDB Compounds: (A:) Hypothetical protein DUF402

SCOP Domain Sequences for d2p12a1:

Sequence; same for both SEQRES and ATOM records:

>d2p12a1 b.175.1.1 (A:8-172) Hypothetical protein RHA1_ro00977 {Rhodococcus sp. RHA1 [TaxId: 101510]}
ihppkveyfdlrdhtntdpkgfvrhvdhyrvepwglymartsdhpqfhyleswllpdlgl
rasifhyhpyhqrdqdhyvdigtftrgddvwksedhyldlvvrtgrdtelldvdelmeah
ttglldtataeqailtattaidgiaahghdlgrwlasigmpidwr

Timeline for d2p12a1:

• d2p12a1 is new in SCOP 1.75
  
• d2p12a1 appears in SCOPe 2.01
  
• d2p12a1 appears in the current release, SCOPe 2.08