Lineage for d2p10e1 (2p10 E:9-204)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 818190Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (7 families) (S)
  5. 818415Family c.1.12.9: Mll9387-like [159416] (1 protein)
    Pfam PF09370; TIM-barrel signal transduction protein; forms a swapped dimer similar to the Phosphoenolpyruvate mutase/Isocitrate lyase-like and HpcH/HpaI aldolase families
  6. 818416Protein Uncharacterized protein Mll9387 [159417] (1 species)
  7. 818417Species Mesorhizobium loti [TaxId:381] [159418] (1 PDB entry)
    Uniprot Q981G2 8-284
  8. 818422Domain d2p10e1: 2p10 E:9-204 [149148]
    automatically matched to 2P10 A:8-204
    complexed with act, cl, gol

Details for d2p10e1

PDB Entry: 2p10 (more details), 2.15 Å

PDB Description: crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution
PDB Compounds: (E:) Mll9387 protein

SCOP Domain Sequences for d2p10e1:

Sequence, based on SEQRES records: (download)

>d2p10e1 c.1.12.9 (E:9-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]}
rptrselvdrfqkkiragepiigggagtglsakseeagdidliviynsgryrmagrgsla
gllaygnanqivvdmarevlpvvrhtpvlagvngtdpfmvmstflrelkeigfagvqnfp
tvglidglfrqnleetgmsyaqevemiaeahkldllttpyvfspedavamakagadilvc
hmglttggaigarsgk

Sequence, based on observed residues (ATOM records): (download)

>d2p10e1 c.1.12.9 (E:9-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]}
rptrselvdrfqkkiragepiigggagtglsakseeagdidliviynsgryrmagrgsla
gllaygnanqivvdmarevlpvvrhtpvlagvngtdpfmvmstflrelkeigfagvqnfp
tvglidglfrqnleetgmsyaqevemiaeahkldllttpyvfspedavamakagadilvc
hmglttrsgk

SCOP Domain Coordinates for d2p10e1:

Click to download the PDB-style file with coordinates for d2p10e1.
(The format of our PDB-style files is described here.)

Timeline for d2p10e1: