Lineage for d2p10c1 (2p10 C:9-204)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2837913Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2838320Family c.1.12.9: Mll9387-like [159416] (1 protein)
    Pfam PF09370; TIM-barrel signal transduction protein; forms a swapped dimer similar to the Phosphoenolpyruvate mutase/Isocitrate lyase-like and HpcH/HpaI aldolase families
  6. 2838321Protein Uncharacterized protein Mll9387 [159417] (1 species)
  7. 2838322Species Mesorhizobium loti [TaxId:381] [159418] (1 PDB entry)
    Uniprot Q981G2 8-284
  8. 2838325Domain d2p10c1: 2p10 C:9-204 [149146]
    automatically matched to 2P10 A:8-204
    complexed with act, cl, gol

Details for d2p10c1

PDB Entry: 2p10 (more details), 2.15 Å

PDB Description: crystal structure of a putative phosphonopyruvate hydrolase (mll9387) from mesorhizobium loti maff303099 at 2.15 a resolution
PDB Compounds: (C:) Mll9387 protein

SCOPe Domain Sequences for d2p10c1:

Sequence, based on SEQRES records: (download)

>d2p10c1 c.1.12.9 (C:9-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]}
rptrselvdrfqkkiragepiigggagtglsakseeagdidliviynsgryrmagrgsla
gllaygnanqivvdmarevlpvvrhtpvlagvngtdpfmvmstflrelkeigfagvqnfp
tvglidglfrqnleetgmsyaqevemiaeahkldllttpyvfspedavamakagadilvc
hmglttggaigarsgk

Sequence, based on observed residues (ATOM records): (download)

>d2p10c1 c.1.12.9 (C:9-204) Uncharacterized protein Mll9387 {Mesorhizobium loti [TaxId: 381]}
rptrselvdrfqkkiragepiigggagtglsakseeagdidliviynsgryrmagrgsla
gllaygnanqivvdmarevlpvvrhtpvlagvngtdpfmvmstflrelkeigfagvqnfp
tvglidglfrqnleetgmsyaqevemiaeahkldllttpyvfspedavamakagadilvc
hmglttrsgk

SCOPe Domain Coordinates for d2p10c1:

Click to download the PDB-style file with coordinates for d2p10c1.
(The format of our PDB-style files is described here.)

Timeline for d2p10c1: