Class a: All alpha proteins [46456] (289 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) |
Family a.102.1.8: CPF0428-like [158737] (3 proteins) Pfam PF06824; DUF1237 |
Protein Hypothetical protein BT3781 [158738] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [158739] (1 PDB entry) Uniprot Q8A185 39-481 |
Domain d2p0vb_: 2p0v B: [149143] automated match to d2p0va1 |
PDB Entry: 2p0v (more details), 2.1 Å
SCOPe Domain Sequences for d2p0vb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p0vb_ a.102.1.8 (B:) Hypothetical protein BT3781 {Bacteroides thetaiotaomicron [TaxId: 818]} yqtnrpeaskrlfvsqeverqidhikqlltnaklawmfencfpntldttvhfdgkedtfv ytgdihamwlrdsgaqvwpyvqlankdpelkkmlagvinrqfkcinidpyanafnmnseg gewmsdltdmkpelherkweidslcypirlayhywkttgdasvfsdewlqaianvlktfk eqqrkddakgpyrfqrkteraldtmtndgwgnpvkpvgliasafrpsddattfqflvpsn ffavtslrkaaeilntvnrkpalakectaladevekalkkyavcnhpkygkiyafevdgf gnqllmddanvpslialpylgdvkvtdpiyqntrkfvwsednpyffkgsagegiggphig ydmiwpmsimmkaftsqndaeiktcikmlmdtdagtgfmhesfnkndpknftrawfawqn tlfgelilklvnegkvdllnsiq
Timeline for d2p0vb_: