SCOPe 2.06: Domain d2p0vb_: 2p0v B:

Lineage for d2p0vb_ (2p0v B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families)

5. Family a.102.1.8: CPF0428-like [158737] (3 proteins)
   Pfam PF06824; DUF1237

6. Protein Hypothetical protein BT3781 [158738] (1 species)

7. Species Bacteroides thetaiotaomicron [TaxId:818] [158739] (1 PDB entry)
   Uniprot Q8A185 39-481

8. Domain d2p0vb_: 2p0v B: [149143]
   automated match to d2p0va1

Details for d2p0vb_

PDB Entry: 2p0v, 2.1 Å

PDB Description: crystal structure of bt3781 protein from bacteroides thetaiotaomicron, northeast structural genomics target btr58

PDB Compounds: (B:) Hypothetical protein BT3781

SCOPe Domain Sequences for d2p0vb_:

Sequence; same for both SEQRES and ATOM records:

>d2p0vb_ a.102.1.8 (B:) Hypothetical protein BT3781 {Bacteroides thetaiotaomicron [TaxId: 818]}
yqtnrpeaskrlfvsqeverqidhikqlltnaklawmfencfpntldttvhfdgkedtfv
ytgdihamwlrdsgaqvwpyvqlankdpelkkmlagvinrqfkcinidpyanafnmnseg
gewmsdltdmkpelherkweidslcypirlayhywkttgdasvfsdewlqaianvlktfk
eqqrkddakgpyrfqrkteraldtmtndgwgnpvkpvgliasafrpsddattfqflvpsn
ffavtslrkaaeilntvnrkpalakectaladevekalkkyavcnhpkygkiyafevdgf
gnqllmddanvpslialpylgdvkvtdpiyqntrkfvwsednpyffkgsagegiggphig
ydmiwpmsimmkaftsqndaeiktcikmlmdtdagtgfmhesfnkndpknftrawfawqn
tlfgelilklvnegkvdllnsiq

Timeline for d2p0vb_:

• d2p0vb_ first appeared in SCOP 1.75, called d2p0vb1
  
• d2p0vb_ appears in SCOPe 2.05
  
• d2p0vb_ appears in SCOPe 2.07
  
• d2p0vb_ appears in the current release, SCOPe 2.08