Lineage for d2p0vb_ (2p0v B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004252Family a.102.1.8: CPF0428-like [158737] (3 protein domains)
    Pfam PF06824; DUF1237
  6. 2004253Protein Hypothetical protein BT3781 [158738] (1 species)
  7. 2004254Species Bacteroides thetaiotaomicron [TaxId:818] [158739] (1 PDB entry)
    Uniprot Q8A185 39-481
  8. 2004256Domain d2p0vb_: 2p0v B: [149143]
    automated match to d2p0va1

Details for d2p0vb_

PDB Entry: 2p0v (more details), 2.1 Å

PDB Description: crystal structure of bt3781 protein from bacteroides thetaiotaomicron, northeast structural genomics target btr58
PDB Compounds: (B:) Hypothetical protein BT3781

SCOPe Domain Sequences for d2p0vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p0vb_ a.102.1.8 (B:) Hypothetical protein BT3781 {Bacteroides thetaiotaomicron [TaxId: 818]}
yqtnrpeaskrlfvsqeverqidhikqlltnaklawmfencfpntldttvhfdgkedtfv
ytgdihamwlrdsgaqvwpyvqlankdpelkkmlagvinrqfkcinidpyanafnmnseg
gewmsdltdmkpelherkweidslcypirlayhywkttgdasvfsdewlqaianvlktfk
eqqrkddakgpyrfqrkteraldtmtndgwgnpvkpvgliasafrpsddattfqflvpsn
ffavtslrkaaeilntvnrkpalakectaladevekalkkyavcnhpkygkiyafevdgf
gnqllmddanvpslialpylgdvkvtdpiyqntrkfvwsednpyffkgsagegiggphig
ydmiwpmsimmkaftsqndaeiktcikmlmdtdagtgfmhesfnkndpknftrawfawqn
tlfgelilklvnegkvdllnsiq

SCOPe Domain Coordinates for d2p0vb_:

Click to download the PDB-style file with coordinates for d2p0vb_.
(The format of our PDB-style files is described here.)

Timeline for d2p0vb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2p0va1