Lineage for d2p0ta1 (2p0t A:22-169)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1755324Fold a.290: PSPTO4464-like [158709] (1 superfamily)
    multihelical; consists of two subdomains at the ends of a long connecting helix
  4. 1755325Superfamily a.290.1: PSPTO4464-like [158710] (1 family) (S)
    automatically mapped to Pfam PF04751
  5. 1755326Family a.290.1.1: PSPTO4464-like [158711] (1 protein)
    Pfam PF04751; DUF615
  6. 1755327Protein Uncharacterized protein PSPTO4464 [158712] (1 species)
  7. 1755328Species Pseudomonas syringae pv. tomato [TaxId:323] [158713] (1 PDB entry)
    Uniprot Q87WS9 22-169
  8. 1755329Domain d2p0ta1: 2p0t A:22-169 [149141]
    complexed with fmt, peg

Details for d2p0ta1

PDB Entry: 2p0t (more details), 2.19 Å

PDB Description: Structural Genomics, the crystal structure of a conserved putative protein from Pseudomonas syringae pv. tomato str. DC3000
PDB Compounds: (A:) UPF0307 protein PSPTO_4464

SCOPe Domain Sequences for d2p0ta1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p0ta1 a.290.1.1 (A:22-169) Uncharacterized protein PSPTO4464 {Pseudomonas syringae pv. tomato [TaxId: 323]}
lhalvdlgerlttlkadvlaklpltdalrkalaeapkhtaniarkrhilfigklmrdqdq
eailvlldqldastrqynerfhnlerwrdrliagddadlekfvieypdadrqqlrslirq
aqhevarnkppatsrkifkyireldelq

SCOPe Domain Coordinates for d2p0ta1:

Click to download the PDB-style file with coordinates for d2p0ta1.
(The format of our PDB-style files is described here.)

Timeline for d2p0ta1: