SCOPe 2.05: Domain d2p02a2: 2p02 A:148-273

Lineage for d2p02a2 (2p02 A:148-273)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
   duplication: consists of 3 similar intertwined domains
   structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta

4. Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families)

5. Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)

6. Protein S-adenosylmethionine synthetase [55975] (3 species)
   synonym: methionine adenosyltransferase, MAT

7. Species Human (Homo sapiens), isoform type-2 [TaxId:9606] [160759] (2 PDB entries)
   Uniprot P31153 126-251! Uniprot P31153 16-125! Uniprot P31153 252-395
   MAT2A

8. Domain d2p02a2: 2p02 A:148-273 [149133]
   complexed with cl, sam

Details for d2p02a2

PDB Entry: 2p02, 1.21 Å

PDB Description: crystal structure of the alpha subunit of human s-adenosylmethionine synthetase 2

PDB Compounds: (A:) S-adenosylmethionine synthetase isoform type-2

SCOPe Domain Sequences for d2p02a2:

Sequence; same for both SEQRES and ATOM records:

>d2p02a2 d.130.1.1 (A:148-273) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]}
needigagdqglmfgyatdeteecmpltivlahklnaklaelrrngtlpwlrpdsktqvt
vqymqdrgavlpirvhtivisvqhdeevcldemrdalkekvikavvpakyldedtiyhlq
psgrfv

Timeline for d2p02a2:

• d2p02a2 first appeared in SCOP 1.75
  
• d2p02a2 appears in SCOPe 2.04
  
• d2p02a2 appears in SCOPe 2.06
  
• d2p02a2 appears in the current release, SCOPe 2.08