Lineage for d2p02a1 (2p02 A:38-147)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1669649Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily)
    duplication: consists of 3 similar intertwined domains
    structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta
  4. 1669650Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) (S)
  5. 1669651Family d.130.1.1: S-adenosylmethionine synthetase [55974] (1 protein)
  6. 1669652Protein S-adenosylmethionine synthetase [55975] (3 species)
    synonym: methionine adenosyltransferase, MAT
  7. 1669702Species Human (Homo sapiens), isoform type-2 [TaxId:9606] [160759] (2 PDB entries)
    Uniprot P31153 126-251! Uniprot P31153 16-125! Uniprot P31153 252-395
    MAT2A
  8. 1669703Domain d2p02a1: 2p02 A:38-147 [149132]
    complexed with cl, sam

Details for d2p02a1

PDB Entry: 2p02 (more details), 1.21 Å

PDB Description: crystal structure of the alpha subunit of human s-adenosylmethionine synthetase 2
PDB Compounds: (A:) S-adenosylmethionine synthetase isoform type-2

SCOPe Domain Sequences for d2p02a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p02a1 d.130.1.1 (A:38-147) S-adenosylmethionine synthetase {Human (Homo sapiens), isoform type-2 [TaxId: 9606]}
gtflftsesvgeghpdkicdqisdavldahlqqdpdakvacetvaktgmillageitsra
avdyqkvvreavkhigyddsskgfdyktcnvlvaleqqspdiaqgvhldr

SCOPe Domain Coordinates for d2p02a1:

Click to download the PDB-style file with coordinates for d2p02a1.
(The format of our PDB-style files is described here.)

Timeline for d2p02a1: