SCOP 1.75: Domain d2ozza1: 2ozz A:1-228

Lineage for d2ozza1 (2ozz A:1-228)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (3 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (40 proteins)

6. Protein Hypothetical protein YhfZ [159812] (1 species)

7. Species Shigella flexneri [TaxId:623] [159813] (1 PDB entry)
   Uniprot Q83JA6 1-228

8. Domain d2ozza1: 2ozz A:1-228 [149131]
   complexed with so4

Details for d2ozza1

PDB Entry: 2ozz, 2.3 Å

PDB Description: crystal structure of yhfz from shigella flexneri

PDB Compounds: (A:) Hypothetical protein yhfZ

SCOP Domain Sequences for d2ozza1:

Sequence, based on SEQRES records:

>d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]}
mdnkallshvdinnvvcamplpytrlyeglasglkaqfdgipfyyahmrgadirveclln
gvydmavvsrlaaesylsqnnlcialelgphtyvgehqlicrkgesgnvkrvgldsrsad
qkimtdvffgdsdvervdlsyheslqrivkgdvdaviwnvvaeneltmlgleatpltddp
rflqateavvltrvddypmqqllravvdkhallahqqrvvsgeqepsy

Sequence, based on observed residues (ATOM records):

>d2ozza1 c.94.1.1 (A:1-228) Hypothetical protein YhfZ {Shigella flexneri [TaxId: 623]}
mdnkallshvdinnvvcamplpytrlyeglasglkaqfdgipfyyahmrgadirveclln
gvydmavvsrlaaesylsqnnlcialelgphtyvgehqlicrkgesgnvkrvgldsrsad
qkimtdvffgdsdvervdlsyheslqrivkgdvdaviwnvaeneltmlgleatpltddpr
flqateavvltrvddypmqqllravvdkhallahqqrvvsgeqepsy

Timeline for d2ozza1:

• d2ozza1 is new in SCOP 1.75
  
• d2ozza1 appears in SCOPe 2.01
  
• d2ozza1 appears in the current release, SCOPe 2.08