Lineage for d2ozxa1 (2ozx A:1-125)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 882501Fold d.322: PHP14-like [143723] (1 superfamily)
    beta(3)-alpha-beta(2)-alpha-beta; 3 layers, a/b/a; mixed beta-sheet, half-barrel, order: 132456; strands 2 and 5 are antiparallel to the rest
  4. 882502Superfamily d.322.1: PHP14-like [143724] (2 families) (S)
  5. 882503Family d.322.1.1: Janus/Ocnus [143725] (1 protein)
    Pfam PF05005
  6. 882504Protein Phosphohistidine phosphatase 1, PHP14 [143726] (1 species)
    Janus-A homolog
  7. 882505Species Human (Homo sapiens) [TaxId:9606] [143727] (5 PDB entries)
    Uniprot Q9NRX4 1-125! Uniprot Q9NRX4 2-121! Uniprot Q9NRX4 5-122
  8. 882510Domain d2ozxa1: 2ozx A:1-125 [149130]
    automatically matched to d2ai6a1

Details for d2ozxa1

PDB Entry: 2ozx (more details)

PDB Description: solution structure of human phosphohistidine phosphatase 1 in phosphate free form
PDB Compounds: (A:) 14 kDa phosphohistidine phosphatase

SCOP Domain Sequences for d2ozxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ozxa1 d.322.1.1 (A:1-125) Phosphohistidine phosphatase 1, PHP14 {Human (Homo sapiens) [TaxId: 9606]}
mavadlalipdvdidsdgvfkyvlirvhsaprsgapaaeskeivrgykwaeyhadiydkv
sgdmqkqgcdceclgggrishqsqdkkihvygysmaygpaqhaistekikakypdyevtw
andgy

SCOP Domain Coordinates for d2ozxa1:

Click to download the PDB-style file with coordinates for d2ozxa1.
(The format of our PDB-style files is described here.)

Timeline for d2ozxa1: