Lineage for d2ozma2 (2ozm A:376-903)

  1. Root: SCOP 1.75
  2. 883176Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 884269Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 884270Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 884271Family e.8.1.1: DNA polymerase I [56673] (4 proteins)
  6. 884349Protein Family B DNA polymerase [56680] (7 species)
  7. 884362Species Bacteriophage RB69 [TaxId:12353] [56681] (15 PDB entries)
  8. 884370Domain d2ozma2: 2ozm A:376-903 [149116]
    Other proteins in same PDB: d2ozma1
    automatically matched to d1clqa2
    complexed with 3dr, ddg, mg, n5p; mutant

Details for d2ozma2

PDB Entry: 2ozm (more details), 2.86 Å

PDB Description: crystal structure of rb69 gp43 in complex with dna with 5-nitp opposite an abasic site analog
PDB Compounds: (A:) DNA polymerase

SCOP Domain Sequences for d2ozma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ozma2 e.8.1.1 (A:376-903) Family B DNA polymerase {Bacteriophage RB69 [TaxId: 12353]}
qnkvipqgrshpvqpypgafvkepipnrykyvmsfdltslypsiirqvnispetiagtfk
vaplhdyinavaerpsdvyscspngmmyykdrdgvvpteitkvfnqrkehkgymlaaqrn
geiikealhnpnlsvdepldvdyrfdfsdeikekikklsakslnemlfraqrtevagmta
qinrkllinslygalgnvwfryydlrnataittfgqmalqwierkvneylnevcgtegea
fvlygdtdsiyvsadkiidkvgeskfrdtnhwvdfldkfarermepaidrgfremceymn
nkqhlmfmdreaiagpplgskgiggfwtgkkryalnvwdmegtryaepklkimgletqks
stpkavqkalkecirrmlqegeeslqeyfkefekefrqlnyisiasvssanniakydvgg
fpgpkcpfhirgiltynraikgnidapqvvegekvyvlplregnpfgdkciawpsgteit
dlikddvlhwmdytvllektfikplegftsaakldyekkaslfdmfdf

SCOP Domain Coordinates for d2ozma2:

Click to download the PDB-style file with coordinates for d2ozma2.
(The format of our PDB-style files is described here.)

Timeline for d2ozma2: