![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.294: EndoU-like [142876] (1 superfamily) comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075) |
![]() | Superfamily d.294.1: EndoU-like [142877] (2 families) ![]() similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily) |
![]() | Family d.294.1.2: Nsp15 C-terminal domain-like [142881] (1 protein) PfamB PB001946 |
![]() | Protein Nsp15, C-terminal domain [142882] (2 species) |
![]() | Species SARS coronavirus [TaxId:227859] [142883] (3 PDB entries) Uniprot Q6VA80 6620-6774 |
![]() | Domain d2ozkc2: 2ozk C:191-332 [149112] Other proteins in same PDB: d2ozka1, d2ozkb1, d2ozkc1, d2ozkd1 automatically matched to 2OZK A:191-332 |
PDB Entry: 2ozk (more details), 2.9 Å
SCOPe Domain Sequences for d2ozkc2:
Sequence, based on SEQRES records: (download)
>d2ozkc2 d.294.1.2 (C:191-332) Nsp15, C-terminal domain {SARS coronavirus [TaxId: 227859]} etyftqsrdledfkprsqmetdflelamdefiqryklegyafehivygdfshgqlgglhl miglakrsqdsplkledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd lsviskvvkvtidyaeisfmlw
>d2ozkc2 d.294.1.2 (C:191-332) Nsp15, C-terminal domain {SARS coronavirus [TaxId: 227859]} etyftqsrdledfkprsqmetdflelamdefiqryklegyafehivygglhlmiglakrs qdsplkledfipmdstvknyfitdaqcvcsvidlllddfveiiksqdlsviskvvkvtid yaeisfmlw
Timeline for d2ozkc2: