Lineage for d2ozkc2 (2ozk C:191-332)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1052976Fold d.294: EndoU-like [142876] (1 superfamily)
    comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold (54075)
  4. 1052977Superfamily d.294.1: EndoU-like [142877] (2 families) (S)
    similarity to the RNase A-like superfamily (54076) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)
  5. 1052986Family d.294.1.2: Nsp15 C-terminal domain-like [142881] (1 protein)
    PfamB PB001946
  6. 1052987Protein Nsp15, C-terminal domain [142882] (2 species)
  7. 1052991Species SARS coronavirus [TaxId:227859] [142883] (3 PDB entries)
    Uniprot Q6VA80 6620-6774
  8. 1053001Domain d2ozkc2: 2ozk C:191-332 [149112]
    Other proteins in same PDB: d2ozka1, d2ozkb1, d2ozkc1, d2ozkd1
    automatically matched to 2OZK A:191-332

Details for d2ozkc2

PDB Entry: 2ozk (more details), 2.9 Å

PDB Description: structure of an n-terminal truncated form of nendou (nsp15) from sars-coronavirus
PDB Compounds: (C:) Uridylate-specific endoribonuclease

SCOPe Domain Sequences for d2ozkc2:

Sequence, based on SEQRES records: (download)

>d2ozkc2 d.294.1.2 (C:191-332) Nsp15, C-terminal domain {SARS coronavirus [TaxId: 227859]}
etyftqsrdledfkprsqmetdflelamdefiqryklegyafehivygdfshgqlgglhl
miglakrsqdsplkledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd
lsviskvvkvtidyaeisfmlw

Sequence, based on observed residues (ATOM records): (download)

>d2ozkc2 d.294.1.2 (C:191-332) Nsp15, C-terminal domain {SARS coronavirus [TaxId: 227859]}
etyftqsrdledfkprsqmetdflelamdefiqryklegyafehivygglhlmiglakrs
qdsplkledfipmdstvknyfitdaqcvcsvidlllddfveiiksqdlsviskvvkvtid
yaeisfmlw

SCOPe Domain Coordinates for d2ozkc2:

Click to download the PDB-style file with coordinates for d2ozkc2.
(The format of our PDB-style files is described here.)

Timeline for d2ozkc2: