SCOP 1.75: Domain d2ozkc2: 2ozk C:191-332

Lineage for d2ozkc2 (2ozk C:191-332)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.294: EndoU-like [142876] (1 superfamily)
   comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold ((54075))
   comprises several helices and two three-stranded antiparallel beta-sheets; similar architecture to the RNase A-like fold ((54075))

4. Superfamily d.294.1: EndoU-like [142877] (2 families)
   similarity to the RNase A-like superfamily ((54076)) extends to the active site location and architecture; the two structural cores of the RNase A and EndoU superfamilies are interrelated by a topological permutation - transposition of two pereferial beta-strands, suggesting possible distant homology of the two superfamilies (and their unification in a hyperfamily)

5. Family d.294.1.2: Nsp15 C-terminal domain-like [142881] (1 protein)
   PfamB PB001946

6. Protein Nsp15, C-terminal domain [142882] (2 species)

7. Species SARS coronavirus [TaxId:227859] [142883] (3 PDB entries)
   Uniprot Q6VA80 6620-6774

8. Domain d2ozkc2: 2ozk C:191-332 [149112]
   Other proteins in same PDB: d2ozka1, d2ozkb1, d2ozkc1, d2ozkd1
   automatically matched to 2OZK A:191-332

Details for d2ozkc2

PDB Entry: 2ozk, 2.9 Å

PDB Description: structure of an n-terminal truncated form of nendou (nsp15) from sars-coronavirus

PDB Compounds: (C:) Uridylate-specific endoribonuclease

SCOP Domain Sequences for d2ozkc2:

Sequence, based on SEQRES records:

>d2ozkc2 d.294.1.2 (C:191-332) Nsp15, C-terminal domain {SARS coronavirus [TaxId: 227859]}
etyftqsrdledfkprsqmetdflelamdefiqryklegyafehivygdfshgqlgglhl
miglakrsqdsplkledfipmdstvknyfitdaqtgsskcvcsvidlllddfveiiksqd
lsviskvvkvtidyaeisfmlw

Sequence, based on observed residues (ATOM records):

>d2ozkc2 d.294.1.2 (C:191-332) Nsp15, C-terminal domain {SARS coronavirus [TaxId: 227859]}
etyftqsrdledfkprsqmetdflelamdefiqryklegyafehivygglhlmiglakrs
qdsplkledfipmdstvknyfitdaqcvcsvidlllddfveiiksqdlsviskvvkvtid
yaeisfmlw

Timeline for d2ozkc2:

• d2ozkc2 is new in SCOP 1.75
  
• d2ozkc2 appears in SCOPe 2.01
  
• d2ozkc2 appears in the current release, SCOPe 2.08