SCOP 1.75: Domain d2ozkb1: 2ozk B:28-190

Lineage for d2ozkb1 (2ozk B:28-190)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (57 families)

5. Family c.66.1.48: Nsp15 N-terminal domain-like [142625] (1 protein)
   rudiment methyltransferase fold that probably has lost the enzymatic activity; contains extra N-terminal alpha+beta subdomain

6. Protein Nsp15 [142626] (2 species)

7. Species SARS coronavirus [TaxId:227859] [142628] (3 PDB entries)
   Uniprot Q6VA80 6619-6774

8. Domain d2ozkb1: 2ozk B:28-190 [149109]
   Other proteins in same PDB: d2ozka2, d2ozkb2, d2ozkc2, d2ozkd2
   automatically matched to 2OZK A:27-190

Details for d2ozkb1

PDB Entry: 2ozk, 2.9 Å

PDB Description: structure of an n-terminal truncated form of nendou (nsp15) from sars-coronavirus

PDB Compounds: (B:) Uridylate-specific endoribonuclease

SCOP Domain Sequences for d2ozkb1:

Sequence; same for both SEQRES and ATOM records:

>d2ozkb1 c.66.1.48 (B:28-190) Nsp15 {SARS coronavirus [TaxId: 227859]}
nnavytkvdgidveifenkttlpvnvafelwakrnikpvpeikilnnlgvdiaantviwd
ykreapahvstigvctmtdiakkptesacssltvlfdgrvegqvdlfrnarngvlitegs
vkgltpskgpaqasvngvtligesvktqfnyfkkvdgiiqqlp

Timeline for d2ozkb1:

• d2ozkb1 is new in SCOP 1.75
  
• d2ozkb1 appears in SCOPe 2.01
  
• d2ozkb1 appears in the current release, SCOPe 2.08