SCOPe 2.08: Domain d2oz6a1: 2oz6 A:143-213

Lineage for d2oz6a1 (2oz6 A:143-213)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.4: CAP C-terminal domain-like [46796] (9 proteins)

6. Protein Cyclic AMP receptor-like protein Vfr [158266] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [158267] (1 PDB entry)
   Uniprot P55222 143-213

8. Domain d2oz6a1: 2oz6 A:143-213 [149103]
   Other proteins in same PDB: d2oz6a2
   protein/DNA complex; complexed with cmp

Details for d2oz6a1

PDB Entry: 2oz6, 2.8 Å

PDB Description: crystal structure of virulence factor regulator from pseudomonas aeruginosa in complex with camp

PDB Compounds: (A:) Virulence Factor Regulator

SCOPe Domain Sequences for d2oz6a1:

Sequence; same for both SEQRES and ATOM records:

>d2oz6a1 a.4.5.4 (A:143-213) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]}
dvtgrvartlldlcqqpdamthpdgmqikitrqeigrivgcsremvgrvlksleeqglvh
vkgktmvvfgt

Timeline for d2oz6a1:

• d2oz6a1 first appeared in SCOP 1.75
  
• d2oz6a1 appears in SCOPe 2.07