SCOPe 2.07: Domain d2oz4a3: 2oz4 A:367-450

Lineage for d2oz4a3 (2oz4 A:367-450)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d2oz4a3: 2oz4 A:367-450 [149101]
   Other proteins in same PDB: d2oz4h1, d2oz4l2
   automated match to d2oz4a3
   complexed with nag, so4, trs, zn

Details for d2oz4a3

PDB Entry: 2oz4, 2.7 Å

PDB Description: structural plasticity in igsf domain 4 of icam-1 mediates cell surface dimerization

PDB Compounds: (A:) Intercellular adhesion molecule 1

SCOPe Domain Sequences for d2oz4a3:

Sequence; same for both SEQRES and ATOM records:

>d2oz4a3 b.1.1.0 (A:367-450) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ygprlderdcpgnwtwpensqqtpmcqawgnplpelkclkdgtfplpigesvtvtrdleg
tylcrarstqgevtrevtvnvlsp

Timeline for d2oz4a3:

• d2oz4a3 first appeared in SCOP 1.75
  
• d2oz4a3 appears in SCOPe 2.06
  
• d2oz4a3 appears in the current release, SCOPe 2.08